Recombinant Mouse Bone morphogenetic protein 6 (Bmp6)
This Recombinant Mouse Bone morphogenetic protein 6 (Bmp6) spans the amino acid sequence from region 372-510aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
VG-1-related protein
UniProt
P20722
Expression Region
372-510aa
Tag
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2905783-01 20 µg
Recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase (ctaB)
Sign In for Pricing
View Details orb2905783-02 100 µg
Recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase (ctaB)
Sign In for Pricing
View Details 
CE553-AE 5 µm
Caprisil NH2-E HPLC Column, 5 µm, 100 Å, CE553-AE x 250 mm
Sign In for Pricing
View Details GTR15311845 1 Vial
Lentiviral human RAB3A shRNA (UAS) - Lentiviral human RAB3A shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
T5595-7287 50 µg
Tissue, Total RNA, Human Adult Normal, Colon ascending, BioGenomicsTM
Sign In for Pricing
View Details