Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 1 (FGF1)

This Recombinant Human Fibroblast growth factor 1 (FGF1) spans the amino acid sequence from region 16-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acidic fibroblast growth factor; Endothelial cell growth factor; Heparin-binding growth factor 1

UniProt

P05230

Expression Region

16-155aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RUNX2 Protein Lysate 20ug
IHURUNX2PLLY20UG 20 µg

Human RUNX2 Protein Lysate 20ug

Sign In for Pricing
View Details
Rabbit Polyclonal RP1 Antibody
NBP2-22149 0.1 mL

Rabbit Polyclonal RP1 Antibody

Sign In for Pricing
View Details
ANP32B siRNA (Human)
orb1861092-01 15 nmol

ANP32B siRNA (Human)

Sign In for Pricing
View Details
ANP32B siRNA (Human)
orb1861092-02 30 nmol

ANP32B siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal MKRN3 Antibody [DyLight 405]
NBP2-81964V 0.1 mL

Rabbit Polyclonal MKRN3 Antibody [DyLight 405]

Sign In for Pricing
View Details
PAPSS2 Blocking Peptide
33R-6976 100 ug

PAPSS2 Blocking Peptide

Sign In for Pricing
View Details