Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1)

This Recombinant Mouse Hyaluronan and proteoglycan link protein 1 (Hapln1) spans the amino acid sequence from region 10-356aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage-linking protein 1; Proteoglycan link protein

UniProt

Q9QUP5

Expression Region

10-356aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTN4 (NM_016221) Human Tagged ORF Clone Lentiviral Particle
RC205235L1V 200 µL

DCTN4 (NM_016221) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PSME1 (IFI5111, Proteasome Activator Complex Subunit 1, 11S Regulator Complex Subunit alpha, Activator of Multicatalytic Protease Subunit 1, Interferon gamma Up-regulated I-5111 Protein, Proteasome Activator 28 Subunit alpha, MGC8628)
131991 100 µg

PSME1 (IFI5111, Proteasome Activator Complex Subunit 1, 11S Regulator Complex Subunit alpha, Activator of Multicatalytic Protease Subunit 1, Interferon gamma Up-regulated I-5111 Protein, Proteasome Activator 28 Subunit alpha, MGC8628)

Sign In for Pricing
View Details
ESAM Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5838R-BF555 100 µL

ESAM Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
ELISA Kit for Microtubule Associated Protein 4 (MAP4)
TRV-0043440-01 24 Tests

ELISA Kit for Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details
ELISA Kit for Microtubule Associated Protein 4 (MAP4)
TRV-0043440-02 48 Tests

ELISA Kit for Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details
ELISA Kit for Microtubule Associated Protein 4 (MAP4)
TRV-0043440-03 96 Tests

ELISA Kit for Microtubule Associated Protein 4 (MAP4)

Sign In for Pricing
View Details