Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparanase (HPSE), partial

This Recombinant Human Heparanase (HPSE), partial spans the amino acid sequence from region 36-109aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endo-glucoronidase; Heparanase-1

UniProt

Q9Y251

Expression Region

36-109aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Endothelial Nitric Oxide Synthase ELISA kit
GTR10401664 96 Well

Chicken Endothelial Nitric Oxide Synthase ELISA kit

Sign In for Pricing
View Details
Rabbit Monoclonal p63/TP73L Antibody (TP40/3980R) [FITC]
NBP3-08775F 100 µL

Rabbit Monoclonal p63/TP73L Antibody (TP40/3980R) [FITC]

Sign In for Pricing
View Details
Slc22a21 (NM_019723) Mouse Tagged ORF Clone Lentiviral Particle
MR224403L4V 200 µL

Slc22a21 (NM_019723) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olfr46 sgRNA CRISPR Lentivector set (Mouse)
K3980701 3x 1.0 µg

Olfr46 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PRDM13 Antibody - C-terminal region : Biotin (ARP39506_T100-Biotin)
ARP39506_T100-Biotin 100 µL

PRDM13 Antibody - C-terminal region : Biotin (ARP39506_T100-Biotin)

Sign In for Pricing
View Details
H-D-4-Pal-OH.2HCl 5g
A23338-5000 5000 mg

H-D-4-Pal-OH.2HCl 5g

Sign In for Pricing
View Details