Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heparanase (HPSE), partial

This Recombinant Human Heparanase (HPSE), partial spans the amino acid sequence from region 36-109aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endo-glucoronidase; Heparanase-1

UniProt

Q9Y251

Expression Region

36-109aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TCP18 Polyclonal Antibody
MBS7167554 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TCP18 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal IRF3 Antibody (3F10) [DyLight 405]
NBP1-04308V 0.1 mL

Mouse Monoclonal IRF3 Antibody (3F10) [DyLight 405]

Sign In for Pricing
View Details
Lentiviral human ADGRV1 shRNA (UAS) - Lentiviral human ADGRV1 shRNA (UAS, RFP) plasmid
GTR15086749 1 Vial

Lentiviral human ADGRV1 shRNA (UAS) - Lentiviral human ADGRV1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
CD45RA (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 650) discontinued
C2400-42-ML650 100 µL

CD45RA (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RAB40A Antibody
46187-01 50 µL

RAB40A Antibody

Sign In for Pricing
View Details
RAB40A Antibody
46187-02 100 µL

RAB40A Antibody

Sign In for Pricing
View Details