Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Insulin-like growth factor 1 (Igf1)

This Recombinant Mouse Insulin-like growth factor 1 (Igf1) spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I; Somatomedin

UniProt

P05017

Expression Region

49-118aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF Polyclonal Antibody, Biotin Conjugated
A58243-100 100 µL

BATF Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rabbit IgG (Fc specific, adsorbed) Goat Polyclonal Antibody
R1367AP 1 mg

Rabbit IgG (Fc specific, adsorbed) Goat Polyclonal Antibody

Sign In for Pricing
View Details
RAF1 Rabbit pAb, BF700 conjugated
orb2827293 100 µL

RAF1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) (NM_006206) Human Tagged ORF Clone Lentiviral Particle
RC211740L4V 200 µL

PDGF Receptor alpha (PDGFRA) (NM_006206) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae csrA Protein (aa 1-63) (strain PittEE)
VAng-Lsx03188-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae csrA Protein (aa 1-63) (strain PittEE)

Sign In for Pricing
View Details
Mouse Protein FAM150B (FAM150B) ELISA Kit
MBS9908820-01 48 Well

Mouse Protein FAM150B (FAM150B) ELISA Kit

Sign In for Pricing
View Details