Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Indian hedgehog protein (Ihh), partial

This Recombinant Mouse Indian hedgehog protein (Ihh), partial spans the amino acid sequence from region 28-202aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HHG-2

UniProt

P97812

Expression Region

28-202aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2,2-Trifluoro-1- (4- (trifluoromethoxy) phenyl) ethanone
PC1025448-01 250 mg

2,2,2-Trifluoro-1- (4- (trifluoromethoxy) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-Trifluoro-1- (4- (trifluoromethoxy) phenyl) ethanone
PC1025448-02 500 mg

2,2,2-Trifluoro-1- (4- (trifluoromethoxy) phenyl) ethanone

Sign In for Pricing
View Details
Stat6 Polyclonal Antibody
BT-AP08644-01 20 µL

Stat6 Polyclonal Antibody

Sign In for Pricing
View Details
Stat6 Polyclonal Antibody
BT-AP08644-02 50 µL

Stat6 Polyclonal Antibody

Sign In for Pricing
View Details
Stat6 Polyclonal Antibody
BT-AP08644-03 100 µL

Stat6 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit
MBS2702492-01 24 Strip Well

Rabbit Hypoxia Inducible Factor 1 Alpha (HIF1a) ELISA Kit

Sign In for Pricing
View Details