Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-4 (IL4)

This Recombinant Bovine Interleukin-4 (IL4) spans the amino acid sequence from region 25-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1; Lymphocyte stimulatory factor 1

UniProt

P30367

Expression Region

25-135aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis B Core Antigen (HBcAg) Antibody
MBS569000-01 1 mg

Hepatitis B Core Antigen (HBcAg) Antibody

Sign In for Pricing
View Details
Hepatitis B Core Antigen (HBcAg) Antibody
MBS569000-02 5x 1 mg

Hepatitis B Core Antigen (HBcAg) Antibody

Sign In for Pricing
View Details
Human ERLEC1 (NM_001127397) AAV Particle
RC225768A1V 250 µL

Human ERLEC1 (NM_001127397) AAV Particle

Sign In for Pricing
View Details
PDE9A (NM_001001578) Human 3' UTR Clone
SC203216 10 µg

PDE9A (NM_001001578) Human 3' UTR Clone

Sign In for Pricing
View Details
SHARP1 (BHLHE41) (NM_030762) Human Tagged ORF Clone Lentiviral Particle
RC206882L3V 200 µL

SHARP1 (BHLHE41) (NM_030762) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Invasin Antibody (Biotin)
orb401643-01 50 µg

Invasin Antibody (Biotin)

Sign In for Pricing
View Details