Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-4 (IL4)

This Recombinant Bovine Interleukin-4 (IL4) spans the amino acid sequence from region 25-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1; Lymphocyte stimulatory factor 1

UniProt

P30367

Expression Region

25-135aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T-Cell Surface Glycoprotein CD8 Alpha Chain (CD8A) Antibody (Biotin)
abx159414 100 µL

T-Cell Surface Glycoprotein CD8 Alpha Chain (CD8A) Antibody (Biotin)

Sign In for Pricing
View Details
GP40 Polyclonal Conjugated Antibody
C41649 100 µL

GP40 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB646428 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Rtn4rl2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7214905 3x 1.0 µg

Rtn4rl2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-01 0.02 mg (E-Coli)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Sign In for Pricing
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-02 0.1 mg (E-Coli)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Sign In for Pricing
View Details