Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Interleukin-4 (IL4)

This Recombinant Bovine Interleukin-4 (IL4) spans the amino acid sequence from region 25-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell stimulatory factor 1; Lymphocyte stimulatory factor 1

UniProt

P30367

Expression Region

25-135aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Garinii uvrB Protein (aa 1-664)
VAng-Lsx2146-inquire Inquire

Recombinant Borrelia Garinii uvrB Protein (aa 1-664)

Sign In for Pricing
View Details
GIPR, ID (GIPR, Gastric inhibitory polypeptide receptor, Glucose-dependent insulinotropic polypeptide receptor) (MaxLight 650) discontinued
036047-ML650 100 µL

GIPR, ID (GIPR, Gastric inhibitory polypeptide receptor, Glucose-dependent insulinotropic polypeptide receptor) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS514863 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
UBXN2A Human Pre-designed siRNA Set A
HY-RS15396 1 Set

UBXN2A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Dextranase Rabbit Polyclonal Antibody (Cy7)
orb1064795 100 µL

Dextranase Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
BBX Double Nickase Plasmid (m)
sc-427729-NIC 20 µg

BBX Double Nickase Plasmid (m)

Sign In for Pricing
View Details