Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integrin alpha-M (ITGAM), partial

This Recombinant Human Integrin alpha-M (ITGAM), partial spans the amino acid sequence from region 46-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD11 antigen-like family member B; CR-3 alpha chain; Cell surface glycoprotein MAC-1 subunit alpha; Leukocyte adhesion receptor MO1; Neutrophil adherence receptor

UniProt

P11215

Expression Region

46-150aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK1BP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
25072066 1.0 µg DNA

IRAK1BP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZDHHC3 ORF Vector (Human) (pORF)
50802011 1.0 µg DNA

ZDHHC3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PPP1R3B AAV Vector (Rat) (CMV)
37454106 1 µg

PPP1R3B AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
DCLK1 Polyclonal Antibody
ANT-11811-50ug 50 µg

DCLK1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CUL5 (His)
BP4349-50ug 50 µg

Recombinant Human CUL5 (His)

Sign In for Pricing
View Details
DGAT2L4 Antibody - C-terminal region
ARP44425_P050-25UL 25 µL

DGAT2L4 Antibody - C-terminal region

Sign In for Pricing
View Details