Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GTPase KRas (KRAS) (G12C), partial

This Recombinant Human GTPase KRas (KRAS) (G12C), partial spans the amino acid sequence from region 1-169aa (G12C) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras

UniProt

P01116

Expression Region

1-169aa (G12C)

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL
BNC042554-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Col4a2 activation kit by CRISPRa
GA200815 1 Kit

Mouse Col4a2 activation kit by CRISPRa

Sign In for Pricing
View Details
COASY (NM_001042531) Human Recombinant Protein
TP315287M 100 µg

COASY (NM_001042531) Human Recombinant Protein

Sign In for Pricing
View Details
D Box Binding Protein (DBP) (NM_001352) Human Over-expression Lysate
LC419967 20 µg

D Box Binding Protein (DBP) (NM_001352) Human Over-expression Lysate

Sign In for Pricing
View Details
CD2 Recombinant Rabbit monoclonal Antibody
HA751033 100 µL

CD2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LRP2BP (NM_018409) Human Recombinant Protein
TP319339L 1 mg

LRP2BP (NM_018409) Human Recombinant Protein

Sign In for Pricing
View Details