Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lutropin subunit beta (Lhb)

This Recombinant Mouse Lutropin subunit beta (Lhb) spans the amino acid sequence from region 21-141aa. Purity: 232

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

UniProt

O09108

Expression Region

21-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fascin (FSCN1) Rabbit Polyclonal Antibody
TA376359 100 µL

Fascin (FSCN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human BRDG 1 (STAP1) activation kit by CRISPRa
GA108804 1 Kit

Human BRDG 1 (STAP1) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Nitroso Tofenacin-d5
TRC-O695402-5MG 5 mg

N-Nitroso Tofenacin-d5

Sign In for Pricing
View Details
CD162 (SELPLG) (NM_003006) Human Over-expression Lysate
LY418961 100 µg

CD162 (SELPLG) (NM_003006) Human Over-expression Lysate

Sign In for Pricing
View Details
Rarg Mouse Gene Knockout Kit (CRISPR)
KN514483 1 Kit

Rarg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL
BNC470892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details