Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lutropin subunit beta (Lhb)

This Recombinant Mouse Lutropin subunit beta (Lhb) spans the amino acid sequence from region 21-141aa. Purity: 232

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

UniProt

O09108

Expression Region

21-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (CA72/733), CF568 conjugate, 0.1mg/mL
BNC680733-500 1x 500 µL

TAG-72 / CA72.4 (CA72/733), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Azurocidin 1 (AZU1) ELISA Kit
RD-AZU1-Hu-01 96 Tests

Human Azurocidin 1 (AZU1) ELISA Kit

Sign In for Pricing
View Details
Human Azurocidin 1 (AZU1) ELISA Kit
RD-AZU1-Hu-02 48 Tests

Human Azurocidin 1 (AZU1) ELISA Kit

Sign In for Pricing
View Details
ETFA (C-term) Goat Polyclonal Antibody
AP21285PU-N 100 µg

ETFA (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Fezakinumab Biosimilar - Research Grade
ICH5176-10mg 10 mg (2x 5 mg)

Fezakinumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), 1mg/mL
BNUM1198-50 1x 50 µL

Cytokeratin 7 (KRT7/1198), 1mg/mL

Sign In for Pricing
View Details