Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lutropin subunit beta (Lhb)

This Recombinant Mouse Lutropin subunit beta (Lhb) spans the amino acid sequence from region 21-141aa. Purity: 232

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

UniProt

O09108

Expression Region

21-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELAFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMACDLPHLPGLLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMBR (NM_002511) Human Over-expression Lysate
LY400899 100 µg

NMBR (NM_002511) Human Over-expression Lysate

Sign In for Pricing
View Details
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]
CF807833 100 µg

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL
BNC472098-500 1x 500 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serotonin N acetyltransferase (AANAT) Mouse Monoclonal Antibody [Clone ID: OTI3B9]
CF810171 100 µg

Serotonin N acetyltransferase (AANAT) Mouse Monoclonal Antibody [Clone ID: OTI3B9]

Sign In for Pricing
View Details
1,1'-Bis(2,6-dichlorophenyl)-[5,5'-biindoline]-2,2'-dione
TRC-B426230-25MG 25 mg

1,1'-Bis(2,6-dichlorophenyl)-[5,5'-biindoline]-2,2'-dione

Sign In for Pricing
View Details
CD43 (SPN/1094), CF594 conjugate, 0.1mg/mL
BNC941094-100 1x 100 µL

CD43 (SPN/1094), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details