Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lutropin subunit beta (Lhb)

This Recombinant Rat Lutropin subunit beta (Lhb) spans the amino acid sequence from region 21-141aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

UniProt

P01230

Expression Region

21-141aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP5K1 alpha (PIP5K1A) (N-term) Rabbit Polyclonal Antibody
AP14962PU-N 400 µL

PIP5K1 alpha (PIP5K1A) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olutasidenib
TRC-O299810-10MG 10 mg

Olutasidenib

Sign In for Pricing
View Details
ZNF674 (N-term) Rabbit Polyclonal Antibody
AP54710PU-N 400 µL

ZNF674 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cryptosporidium TaqMan Probe/Primer and Control Set
TM39110 100 Reactions

Cryptosporidium TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C4]
TA500335BM 100 µL

GFAP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C4]

Sign In for Pricing
View Details
RPA70 Antibody
KC-6465-01 50 μL

RPA70 Antibody

Sign In for Pricing
View Details