Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

This Recombinant Human Glucocorticoid receptor (NR3C1), partial spans the amino acid sequence from region 521-777aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 1

UniProt

P04150

Expression Region

521-777aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p95 NBS1 (NBN) (C-term) Rabbit Polyclonal Antibody
AP52817PU-N 400 µL

p95 NBS1 (NBN) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dosimeter BDOS-101
BDOS-101 1 Unit

Dosimeter BDOS-101

Sign In for Pricing
View Details
CCL3 (NM_002983) Human Over-expression Lysate
LY418970 100 µg

CCL3 (NM_002983) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL
BNC741556-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ME2 (NM_002396) Human Over-expression Lysate
LY419348 100 µg

ME2 (NM_002396) Human Over-expression Lysate

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF488A conjugate, 0.1mg/mL
BNC882829-500 1x 500 µL

Golgi Complex (Marker for Human Cells) (GLG1/2829R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details