Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucocorticoid receptor (NR3C1), partial

This Recombinant Human Glucocorticoid receptor (NR3C1), partial spans the amino acid sequence from region 521-777aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 3 group C member 1

UniProt

P04150

Expression Region

521-777aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MFT1 Polyclonal Antibody
MBS7157121 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MFT1 Polyclonal Antibody

Sign In for Pricing
View Details
Itgbl1 siRNA Oligos set (Mouse)
25180174 3x 5 nmol

Itgbl1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
PCDC1 rabbit pAb
E44H12193 100 µL

PCDC1 rabbit pAb

Sign In for Pricing
View Details
Recombinant Rhesus Macaque G-CSF
EEOPP-0701 10 µg

Recombinant Rhesus Macaque G-CSF

Sign In for Pricing
View Details
Keratin, Type II Cuticular Hb2 (KRT82) Antibody
abx032393-01 80 µL

Keratin, Type II Cuticular Hb2 (KRT82) Antibody

Sign In for Pricing
View Details
Keratin, Type II Cuticular Hb2 (KRT82) Antibody
abx032393-02 400 µL

Keratin, Type II Cuticular Hb2 (KRT82) Antibody

Sign In for Pricing
View Details