Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tubulin-specific chaperone A (TBCA)

This Recombinant Human Tubulin-specific chaperone A (TBCA) spans the amino acid sequence from region 2-108aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TCP1-chaperonin cofactor A; Tubulin-folding cofactor A

UniProt

O75347

Expression Region

2-108aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Lysine-4,4,5,5-d4 Hydrochloride
TRC-L468917-5MG 5 mg

L-Lysine-4,4,5,5-d4 Hydrochloride

Sign In for Pricing
View Details
Fmoc-Trp (Boc) TentaGel® S AC Resin
SA1128.25G 25 g

Fmoc-Trp (Boc) TentaGel® S AC Resin

Sign In for Pricing
View Details
Vstm2b Mouse Gene Knockout Kit (CRISPR)
KN519282 1 Kit

Vstm2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Desfluorobutyrophenone 9 Oxo- Lumateperone
TRC-D284350-10MG 10 mg

Desfluorobutyrophenone 9 Oxo- Lumateperone

Sign In for Pricing
View Details
Human MBD3 activation kit by CRISPRa
GA110016 1 Kit

Human MBD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cynarin
TRC-C991475-10MG 10 mg

Cynarin

Sign In for Pricing
View Details