Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tgfb1

UniProt

P04202

Expression Region

279-390aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DDX19B Antibody
A10099-1 100 µL

Anti-DDX19B Antibody

Sign In for Pricing
View Details
Human Peroxiredoxin-3 (PRDX3) AssayLite™ Antibody (FITC Conjugate)
30271-05141 2x 75 µg

Human Peroxiredoxin-3 (PRDX3) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
SLIT2 Rabbit Polyclonal Antibody (Fluoro647)
orb3113331 100 µg

SLIT2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Brain Dissociation System 3 (Hippocampal neurons), Mouse and Rat
4-20223 Each

Brain Dissociation System 3 (Hippocampal neurons), Mouse and Rat

Sign In for Pricing
View Details
ADCY5/6 Antibody
ABD3508 100 µg

ADCY5/6 Antibody

Sign In for Pricing
View Details
Recombinant Mouse TNFSF12 Protein, His (Fc)-Avi-tagged
TNFSF12-9483M 50 µg

Recombinant Mouse TNFSF12 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details