Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tgfb1

UniProt

P04202

Expression Region

279-390aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1- (2,5-dichlorophenyl) -2-hydroxyiminoacetamide
OR28537 1 Each

N1- (2,5-dichlorophenyl) -2-hydroxyiminoacetamide

Sign In for Pricing
View Details
Human VWF (764-2813) Protein, His Tag
E33P100684 10 µg

Human VWF (764-2813) Protein, His Tag

Sign In for Pricing
View Details
Human VIPR1/VPAC1 Antibody
E55A06773 100 µg

Human VIPR1/VPAC1 Antibody

Sign In for Pricing
View Details
MIOX, NT (MIOX, ALDRL6, KSP32, RSOR, Inositol oxygenase, Aldehyde reductase-like 6, Kidney-specific protein 32, Myo-inositol oxygenase, Renal-specific oxidoreductase) (MaxLight 750) discontinued
038441-ML750 100 µL

MIOX, NT (MIOX, ALDRL6, KSP32, RSOR, Inositol oxygenase, Aldehyde reductase-like 6, Kidney-specific protein 32, Myo-inositol oxygenase, Renal-specific oxidoreductase) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RNF43 Antibody
MBS9414465-01 0.1 mL

RNF43 Antibody

Sign In for Pricing
View Details
RNF43 Antibody
MBS9414465-02 5x 0.1 mL

RNF43 Antibody

Sign In for Pricing
View Details