Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Tumor necrosis factor (TNF), partial

This Recombinant Macaca mulatta Tumor necrosis factor (TNF), partial spans the amino acid sequence from region 77-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2

UniProt

P48094

Expression Region

77-233aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS800112 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CD46 (197-2B1), CF740 conjugate, 0.1mg/mL
BNC740931-500 1x 500 µL

CD46 (197-2B1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM5C (BRINP3) Rabbit Polyclonal Antibody
TA374083 100 µL

FAM5C (BRINP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) (NM_000360) Human Recombinant Protein
TP311218L 1 mg

Tyrosine Hydroxylase (TH) (NM_000360) Human Recombinant Protein

Sign In for Pricing
View Details
RB associated KRAB repressor (RBAK) Human Gene Knockout Kit (CRISPR)
KN424517 1 Kit

RB associated KRAB repressor (RBAK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS715482 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details