Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein zeta/delta (YWHAZ)

This Recombinant Human 14-3-3 protein zeta/delta (YWHAZ) spans the amino acid sequence from region 1-245aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein kinase C inhibitor protein 1

UniProt

P63104

Expression Region

1-245aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Petroleum Ether 40-60°C, GlenDry™, anhydrous
GS3913-100ml 100 mL

Petroleum Ether 40-60°C, GlenDry™, anhydrous

Sign In for Pricing
View Details
SNRPEP7 Recombinant Protein (Human)
RP099255 100 µg

SNRPEP7 Recombinant Protein (Human)

Sign In for Pricing
View Details
SFXN3 Protein Vector (Mouse) (pPM-C-His)
PV228573 500 ng

SFXN3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Nup98 3'UTR Luciferase Stable Cell Line
TU114449 1.0 mL

Nup98 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Canine Cell division cycle (CDC) ELISA Kit
NSL0148Ca 96 Tests

Canine Cell division cycle (CDC) ELISA Kit

Sign In for Pricing
View Details
Human Dystrophin (DMD) (NM_004016) AAV Particle
RC218887A1V 250 µL

Human Dystrophin (DMD) (NM_004016) AAV Particle

Sign In for Pricing
View Details