Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 35 Protein E7 (E7)

This Recombinant Human papillomavirus 35 Protein E7 (E7) spans the amino acid sequence from region 1-99aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7

UniProt

P27230

Expression Region

1-99aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus 35

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGEITTLQDYVLDLEPEATDLYCYEQLCDSSEEEEDTIDGPAGQAKPDTSNYNIVTSCCKCEATLRLCVQSTHIDIRKLEDLLMGTFGIVCPGCSQRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vacuolar protein sorting-associated protein 33B (VPS33B) Antibody
abx214894-01 50 µL

Vacuolar protein sorting-associated protein 33B (VPS33B) Antibody

Sign In for Pricing
View Details
Vacuolar protein sorting-associated protein 33B (VPS33B) Antibody
abx214894-02 100 µL

Vacuolar protein sorting-associated protein 33B (VPS33B) Antibody

Sign In for Pricing
View Details
Human SOX13 Pre-designed siRNA Set A
SI015515A 1 Each

Human SOX13 Pre-designed siRNA Set A

Sign In for Pricing
View Details
uronyl 2 suLfotransferase (UST) (NM_005715) Human Tagged Lenti ORF Clone
RC210799L3 10 µg

uronyl 2 suLfotransferase (UST) (NM_005715) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dis3l2 Mouse qPCR Template Standard (NM_153530)
MK201385 1 Kit

Dis3l2 Mouse qPCR Template Standard (NM_153530)

Sign In for Pricing
View Details
ABCC10 Human shRNA Lentiviral Particle (Locus ID 89845)
TL306919V 500 µL Each

ABCC10 Human shRNA Lentiviral Particle (Locus ID 89845)

Sign In for Pricing
View Details