Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max 1-aminocyclopropane-1-carboxylate synthase (ACS1)

This Recombinant Glycine max 1-aminocyclopropane-1-carboxylate synthase (ACS1) spans the amino acid sequence from region 1-484aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S-adenosyl-L-methionine methylthioadenosine-lyase

UniProt

P31531

Expression Region

1-484aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGLMDVDQTQLLSKMVIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGGATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALEDAYEKAKEDNIRVKGLLITNPSNPLGTVMDRNTLRTVMSFINEKRIHLVSDEIYSATVFSHPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVHCARKMSSFGLVSTQTQYLLASMLNDDEFVESFLVESAKRLAQRHRVFTGGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIDEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIALQRIRNFVLQNKEIMVPNKKHCWHSNLRLSLKTRRFDDIMMSPHSPIPQSPLVKATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDHP23 AAV Vector (Human) (CMV)
21257101 1 µg

GAPDHP23 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Calponin Rabbit pAb
E45R23237N-50 50 µL

Calponin Rabbit pAb

Sign In for Pricing
View Details
PABPC1 Antibody Blocking Peptide
orb1504743 500 µg

PABPC1 Antibody Blocking Peptide

Sign In for Pricing
View Details
PAX6 Rabbit Polyclonal Antibody (AP)
orb871051 100 µL

PAX6 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Rfk (NM_019437) Mouse Tagged ORF Clone
MR201161 10 µg

Rfk (NM_019437) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PARK7 ELISA Kit (Human) (OKAN04928)
OKAN04928 96 Well

PARK7 ELISA Kit (Human) (OKAN04928)

Sign In for Pricing
View Details