Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 26 Protein E7 (E7)

This Recombinant Human papillomavirus type 26 Protein E7 (E7) spans the amino acid sequence from region 1-104aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7

UniProt

P36824

Expression Region

1-104aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 26

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGNIINIEDVILDLVPQPEIDLRCYEQLDYEQFDSSDEDETDNMRDQQARQAGQEVCYRIEAQCCMCNSIVQLAVQSSRQNVRVLEQMLMEDVSLVCHQCAAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD52 Antibody
orb3158246 100 µg

CD52 Antibody

Sign In for Pricing
View Details
TrkC (NTRK3) (NM_001007156) Human Recombinant Protein
TP303781M 100 µg

TrkC (NTRK3) (NM_001007156) Human Recombinant Protein

Sign In for Pricing
View Details
MIP-1b Rabbit Polyclonal Antibody
APRab13907-01 20 µL

MIP-1b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIP-1b Rabbit Polyclonal Antibody
APRab13907-02 50 µL

MIP-1b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIP-1b Rabbit Polyclonal Antibody
APRab13907-03 100 µL

MIP-1b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIP-1b Rabbit Polyclonal Antibody
APRab13907-04 200 µL

MIP-1b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details