Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial

This Recombinant Plasmodium falciparum Merozoite surface protein 2 (MSP2), partial spans the amino acid sequence from region 109-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

45 kDa merozoite surface antigen; Merozoite surface antigen 2

UniProt

P50498

Expression Region

109-246aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Plasmodium falciparum (isolate 3D7)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR562784 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
CD70 (TNFS7/1026), Biotin conjugate, 0.1mg/mL
BNCB1026-500 1x 500 µL

CD70 (TNFS7/1026), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Iduronic Acid Sodium Salt
TRC-I252000-5MG 5 mg

L-Iduronic Acid Sodium Salt

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR560093 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
AP02613PU-S 50 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MED15 Mouse Monoclonal Antibody [Clone ID: OTI2C6]
CF807881 100 µg

MED15 Mouse Monoclonal Antibody [Clone ID: OTI2C6]

Sign In for Pricing
View Details