Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atrax robustus Delta-hexatoxin-Ar1a

This Recombinant Atrax robustus Delta-hexatoxin-Ar1a spans the amino acid sequence from region 1-42aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delta-atracotoxin-Ar1; Delta-atracotoxin-Ar1a; Robustoxin

UniProt

P01478

Expression Region

1-42aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Atrax robustus (Sydney funnel-web spider)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFKKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FOLR2/FBP Protein (His Tag)
PKSH031199 100 µg

Recombinant Human FOLR2/FBP Protein (His Tag)

Sign In for Pricing
View Details
SLC2A11 (NM_001024938) Human Over-expression Lysate
LY422558 100 µg

SLC2A11 (NM_001024938) Human Over-expression Lysate

Sign In for Pricing
View Details
C3orf55 (PQLC2L) (NM_001130002) Human Over-expression Lysate
LC427093 20 µg

C3orf55 (PQLC2L) (NM_001130002) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FAM98B activation kit by CRISPRa
GA117055 1 Kit

Human FAM98B activation kit by CRISPRa

Sign In for Pricing
View Details
Malonyl-L-carnitine-d3 Trifluoroacetate
TRC-M158152-25MG 25 mg

Malonyl-L-carnitine-d3 Trifluoroacetate

Sign In for Pricing
View Details
4-(Cyanophenyl)boronic Acid Pinacol Ester
TRC-C982045-2.5G 2.5 g

4-(Cyanophenyl)boronic Acid Pinacol Ester

Sign In for Pricing
View Details