Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metallothionein-1 (Mt1)

This Recombinant Mouse Metallothionein-1 (Mt1) spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-I

UniProt

P02802

Expression Region

1-61aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSTGGSCTCTSSCACKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGAADKCTCCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHO Monoclonal beta-NGF Antibody (fasinumab) - (Dry Ice)
NBP3-28872-100ug 100 µg

CHO Monoclonal beta-NGF Antibody (fasinumab) - (Dry Ice)

Sign In for Pricing
View Details
IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG
MBS6382158-01 0.1 mL

IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG

Sign In for Pricing
View Details
IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG
MBS6382158-02 5x 0.1 mL

IFIT3 (Interferon-induced Protein with Tetratricopeptide Repeats 3, IFIT-3, CIG49, ISG-60, Interferon-induced 60kD Protein, IFI-60K, Interferon-induced Protein with Tetratricopeptide Repeats 4, IFIT-4, Retinoic Acid-induced Gene G-Protein, P60, RIG-G, CIG

Sign In for Pricing
View Details
ITGB1BP3 3'UTR Lenti-reporter-Luc Vector
25168081 1.0 µg

ITGB1BP3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Peroxidase Conjugated Affinity Purified anti-Mouse IgG [H&L] [Donkey]
orb1675002 250 µg

Peroxidase Conjugated Affinity Purified anti-Mouse IgG [H&L] [Donkey]

Sign In for Pricing
View Details
Enkephalin peptide
orb233814-01 1 mg

Enkephalin peptide

Sign In for Pricing
View Details