Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metallothionein-1 (Mt1)

This Recombinant Mouse Metallothionein-1 (Mt1) spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-I

UniProt

P02802

Expression Region

1-61aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSTGGSCTCTSSCACKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGAADKCTCCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2084207 1.0 µg DNA

S100G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal PDLIM7 Antibody
NBP2-58734-25ul 25 µL

Rabbit Polyclonal PDLIM7 Antibody

Sign In for Pricing
View Details
Recombinant Mouse EDA2R
Pr22234-01 10 µg

Recombinant Mouse EDA2R

Sign In for Pricing
View Details
Recombinant Mouse EDA2R
Pr22234-02 50 µg

Recombinant Mouse EDA2R

Sign In for Pricing
View Details
Recombinant Mouse EDA2R
Pr22234-03 500 µg

Recombinant Mouse EDA2R

Sign In for Pricing
View Details
Recombinant Mouse EDA2R
Pr22234-04 1 mg

Recombinant Mouse EDA2R

Sign In for Pricing
View Details