Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Metallothionein-1 (Mt1)

This Recombinant Mouse Metallothionein-1 (Mt1) spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallothionein-I

UniProt

P02802

Expression Region

1-61aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPNCSCSTGGSCTCTSSCACKNCKCTSCKKSCCSCCPVGCSKCAQGCVCKGAADKCTCCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse LRRC41 Protein, His (Fc)-Avi-tagged
LRRC41-5187M 50 µg

Recombinant Mouse LRRC41 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Tectb 3'UTR GFP Stable Cell Line
TU271753 1.0 mL

Tectb 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
UNC5D Rabbit Polyclonal Antibody (BF750)
orb2543803 100 µL

UNC5D Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Lentiviral mouse 45909 shRNA (UAS) - Lentiviral mouse 45909 shRNA (UAS) (100)
GTR15302265 1 Vial

Lentiviral mouse 45909 shRNA (UAS) - Lentiviral mouse 45909 shRNA (UAS) (100)

Sign In for Pricing
View Details
CD16/Fcgr3 Rabbit Polyclonal Antibody (APC)
orb2599255 100 µg

CD16/Fcgr3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rat Anti-Mouse CD3ε-FITC
1535-02S 0.1 mg

Rat Anti-Mouse CD3ε-FITC

Sign In for Pricing
View Details