Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor I (IGF1)

This Recombinant Human Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insulin-like growth factor I; Mechano growth factor; Somatomedin-C

UniProt

P05019

Expression Region

49-118aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLGF2, Sf9
cyt-420-01 2µg

PLGF2, Sf9

Sign In for Pricing
View Details
PLGF2, Sf9
cyt-420-02 10µg

PLGF2, Sf9

Sign In for Pricing
View Details
PLGF2, Sf9
cyt-420-03 1mg

PLGF2, Sf9

Sign In for Pricing
View Details
ADD2 Antibody
CSB-PA001349GA01HU 100 µL

ADD2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Carbohydrate Sulfotransferase 6/CHST6 Antibody (OTI1D1) [DyLight 755]
NBP2-71195IR 0.1 mL

Mouse Monoclonal Carbohydrate Sulfotransferase 6/CHST6 Antibody (OTI1D1) [DyLight 755]

Sign In for Pricing
View Details
Nebulette Rabbit Polyclonal Antibody (AP)
orb873886 100 µL

Nebulette Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details