Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70)

This Recombinant Mycobacterium bovis Immunogenic protein MPB70 (mpb70) spans the amino acid sequence from region 31-193aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mpb70

UniProt

P0A669

Expression Region

31-193aa

Tag

N-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIDEB (Biotin)
558646-01 50 µg

CIDEB (Biotin)

Sign In for Pricing
View Details
CIDEB (Biotin)
558646-02 100 µg

CIDEB (Biotin)

Sign In for Pricing
View Details
IRF2BPL Rabbit pAb, IRDye 800CW conjugated
orb2847402 100 µL

IRF2BPL Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Freezer box divider, 49 hole 12/pk
FBCD-3000 1 Pack

Freezer box divider, 49 hole 12/pk

Sign In for Pricing
View Details
Auraptene (Standard)
HY-N2388R-01 5 mg

Auraptene (Standard)

Sign In for Pricing
View Details
Auraptene (Standard)
HY-N2388R-02 10 mg

Auraptene (Standard)

Sign In for Pricing
View Details