Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage MS2 Capsid protein

This Recombinant Escherichia phage MS2 Capsid protein spans the amino acid sequence from region 2-130aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coat protein; CP

UniProt

P03612

Expression Region

2-130aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Escherichia phage MS2 (Bacteriophage MS2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-MAGE-A5/Magea5 Polyclonal Antibody
PAV8741 100 μL

Rabbit Anti-MAGE-A5/Magea5 Polyclonal Antibody

Sign In for Pricing
View Details
Oct4 (POU5F1) Mouse Monoclonal Antibody [Clone ID: OTI9B7]
TA500035 100 µL

Oct4 (POU5F1) Mouse Monoclonal Antibody [Clone ID: OTI9B7]

Sign In for Pricing
View Details
β-actin Rabbit Rabbit Polyclonal Antibody (A284)
ES8450-01 50 µL

β-actin Rabbit Rabbit Polyclonal Antibody (A284)

Sign In for Pricing
View Details
β-actin Rabbit Rabbit Polyclonal Antibody (A284)
ES8450-02 100 µL

β-actin Rabbit Rabbit Polyclonal Antibody (A284)

Sign In for Pricing
View Details
Olfr1341 Mouse siRNA Oligo Duplex (Locus ID 258852)
SR409778 1 Kit

Olfr1341 Mouse siRNA Oligo Duplex (Locus ID 258852)

Sign In for Pricing
View Details
Methylglyoxal-bis-2,4-dnph
BAA10769-01 5 mg

Methylglyoxal-bis-2,4-dnph

Sign In for Pricing
View Details