Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

This Recombinant Mouse Angiopoietin-related protein 4 (Angptl4) spans the amino acid sequence from region 24-410aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

425O18-1; Angiopoietin-like protein 4; Fasting-induced adipose factor; Hepatic fibrinogen/angiopoietin-related protein; Secreted protein Bk89

UniProt

Q9Z1P8

Expression Region

24-410aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YceI Antibody
orb830616 2 mg

YceI Antibody

Sign In for Pricing
View Details
CD33 (gp67, Myeloid Marker) (PE)
C2385-02E 100 Tests

CD33 (gp67, Myeloid Marker) (PE)

Sign In for Pricing
View Details
Lentiviral human CBR3 shRNA (UAS) - Lentiviral human CBR3 shRNA (UAS) plasmid
GTR15091267 1 Vial

Lentiviral human CBR3 shRNA (UAS) - Lentiviral human CBR3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Thioalkalivibrio sp. Membrane protein insertase YidC (yidC), partial
MBS7068498 Inquire

Recombinant Thioalkalivibrio sp. Membrane protein insertase YidC (yidC), partial

Sign In for Pricing
View Details
Recombinant Acidovorax sp. Fructose-1,6-bisphosphatase class 1 (fbp)
MBS1010732-01 0.02 mg (E-Coli)

Recombinant Acidovorax sp. Fructose-1,6-bisphosphatase class 1 (fbp)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. Fructose-1,6-bisphosphatase class 1 (fbp)
MBS1010732-02 0.02 mg (Yeast)

Recombinant Acidovorax sp. Fructose-1,6-bisphosphatase class 1 (fbp)

Sign In for Pricing
View Details