Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger HIT domain-containing protein 3 (ZNHIT3)

This Recombinant Human Zinc finger HIT domain-containing protein 3 (ZNHIT3) spans the amino acid sequence from region 1-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HNF-4a coactivator; Thyroid hormone receptor interactor 3; Thyroid receptor-interacting protein 3

UniProt

Q15649

Expression Region

1-155aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRIP3 Antibody, FITC conjugated
A67718-100UG 100 µg

NRIP3 Antibody, FITC conjugated

Sign In for Pricing
View Details
STX19 Antibody; HRP conjugated
MBS7002852-01 0.05 mg

STX19 Antibody; HRP conjugated

Sign In for Pricing
View Details
STX19 Antibody; HRP conjugated
MBS7002852-02 0.1 mg

STX19 Antibody; HRP conjugated

Sign In for Pricing
View Details
STX19 Antibody; HRP conjugated
MBS7002852-03 5x 0.1 mg

STX19 Antibody; HRP conjugated

Sign In for Pricing
View Details
MED24
525290-01 100 µL

MED24

Sign In for Pricing
View Details
MED24
525290-02 200 µL

MED24

Sign In for Pricing
View Details