Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial

This Recombinant Mouse Mas-related G-protein coupled receptor member B2 (Mrgprb2), partial spans the amino acid sequence from region 1-40aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mrgprb2

UniProt

Q3KNA1

Expression Region

1-40aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEA1P3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV750093 1.0 µg DNA

TCEA1P3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
COL5A2 (Collagen, Type V, alpha 2, MGC105115) (MaxLight 405) discontinued
244838-ML405 100 µL

COL5A2 (Collagen, Type V, alpha 2, MGC105115) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CDK-TCIP2
orb2695340-01 50 mg

CDK-TCIP2

Sign In for Pricing
View Details
CDK-TCIP2
orb2695340-02 10 mg

CDK-TCIP2

Sign In for Pricing
View Details
IL17REL Protein Vector (Human) (pPM-C-HA)
24835021 500 ng

IL17REL Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Spnb4 ORF Vector (Mouse) (pORF)
45356014 1.0 µg DNA

Spnb4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details