Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial

This Recombinant Human UDP-glucuronosyltransferase 3A2 (UGT3A2), partial spans the amino acid sequence from region 23-483aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UDPGT 3A2; UGT3A2; PSEC0073, UNQ842/PRO1780

UniProt

Q3SY77

Expression Region

23-483aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKILTISTVGGSHYLLMDRVSQILQDHGHNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKDIMDSLKNENFDMVIVETFDYCPFLIAEKLGKPFVAILSTSFGSLEFGLPIPLSYVPVFRSLLTDHMDFWGRVKNFLMFFSFCRRQQHMQSTFDNTIKEHFTEGSRPVLSHLLLKAELWFINSDFAFDFARPLLPNTVYVGGLMEKPIKPVPQDLENFIAKFGDSGFVLVTLGSMVNTCQNPEIFKEMNNAFAHLPQGVIWKCQCSHWPKDVHLAANVKIVDWLPQSDLLAHPSIRLFVTHGGQNSIMEAIQHGVPMVGIPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIMEDKRYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWHEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDV3 (NM_001134422) Human Over-expression Lysate
LY427429 100 µg

CDV3 (NM_001134422) Human Over-expression Lysate

Sign In for Pricing
View Details
TXNDC5 Antibody
OC-106-01 50 μL

TXNDC5 Antibody

Sign In for Pricing
View Details
TXNDC5 Antibody
OC-106-02 100 µL

TXNDC5 Antibody

Sign In for Pricing
View Details
TXNDC5 Antibody
OC-106-03 1 mL

TXNDC5 Antibody

Sign In for Pricing
View Details
2-Amino-4-chloropyridine
TRC-A603512-25G 25 g

2-Amino-4-chloropyridine

Sign In for Pricing
View Details
Human ODAD3 activation kit by CRISPRa
GA114554 1 Kit

Human ODAD3 activation kit by CRISPRa

Sign In for Pricing
View Details