Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-type natriuretic peptide (Nppc)

This Recombinant Mouse C-type natriuretic peptide (Nppc) spans the amino acid sequence from region 74-126aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nppc; Cnp

UniProt

Q61839

Expression Region

74-126aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TST Antibody [Alexa Fluor 488]
NBP2-98573AF488 0.1 mL

Rabbit Polyclonal TST Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Anti-MAPT antibody
STJ24499 100 µl

Anti-MAPT antibody

Sign In for Pricing
View Details
Lentiviral human HBD shRNA (UAS) - Lentiviral human HBD shRNA (UAS, iRFP) (100)
GTR15095175 1 Vial

Lentiviral human HBD shRNA (UAS) - Lentiviral human HBD shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
OsI_014491 Antibody
orb838223 2 mg

OsI_014491 Antibody

Sign In for Pricing
View Details
Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (AP)
MBS6248215-01 0.1 mL

Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (AP)

Sign In for Pricing
View Details
Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (AP)
MBS6248215-02 5x 0.1 mL

Parainfluenza Virus Type 3 (Human Parainfluenza 3 Virus, Human Parainfluenza Virus Type 3, hPIV3, HPIV-3, PIV3) (AP)

Sign In for Pricing
View Details