Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adenosine receptor A2a (Adora2a), partial

This Recombinant Mouse Adenosine receptor A2a (Adora2a), partial spans the amino acid sequence from region 286-410aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adora2a

UniProt

Q60613

Expression Region

286-410aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSAPHSGRRPNGYTLGPGGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVGTASWSSEFAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORAI3 Protein Vector (Mouse) (pPM-C-HA)
PV212536 500 ng

ORAI3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
One.Step RT-qPCR Kit with SybrGreen dUTP/UNG no ROX (2X)
105-526 2 x 1,25 ml

One.Step RT-qPCR Kit with SybrGreen dUTP/UNG no ROX (2X)

Sign In for Pricing
View Details
PDCD1/CD279/PD-1 Antibody
orb1535608 50 μL

PDCD1/CD279/PD-1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Rictor Antibody [DyLight 650]
NB100-611C 100 µL

Rabbit Polyclonal Rictor Antibody [DyLight 650]

Sign In for Pricing
View Details
LOC100364217 3'UTR Luciferase Stable Cell Line
TU209016 1.0 mL

LOC100364217 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human TREML1/TLT-1 (C-Fc)
CX07-1mg 1 mg

Recombinant Human TREML1/TLT-1 (C-Fc)

Sign In for Pricing
View Details