Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adenosine receptor A2a (Adora2a), partial

This Recombinant Mouse Adenosine receptor A2a (Adora2a), partial spans the amino acid sequence from region 286-410aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adora2a

UniProt

Q60613

Expression Region

286-410aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSAPHSGRRPNGYTLGPGGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVGTASWSSEFAPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pepsinogen II (PG II) antibody
E35D1133 100 µL

Pepsinogen II (PG II) antibody

Sign In for Pricing
View Details
Mouse Monoclonal TRAF-2 Antibody (33A1293) [Biotin]
NB100-56715B 0.1 mL

Mouse Monoclonal TRAF-2 Antibody (33A1293) [Biotin]

Sign In for Pricing
View Details
Rat Nos1ap ELISA Kit
ELI-10703r 96 Tests

Rat Nos1ap ELISA Kit

Sign In for Pricing
View Details
CYP19A1 antibody
FNab02146 100 µg

CYP19A1 antibody

Sign In for Pricing
View Details
Rbm16 ORF Vector (Rat) (pORF)
ORF074602 1.0 µg DNA

Rbm16 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Nup88 3'UTR GFP Stable Cell Line
TU164447 1.0 mL

Nup88 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details