Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Desert hedgehog protein (Dhh), partial

This Recombinant Mouse Desert hedgehog protein (Dhh), partial spans the amino acid sequence from region 23-198aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HHG-3

UniProt

Q61488

Expression Region

23-198aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MUC16 ELISA Kit
CEK2840 96 Tests

Human MUC16 ELISA Kit

Sign In for Pricing
View Details
Sclt1 3'UTR Lenti-reporter-Luc Vector
43168086 1.0 µg

Sclt1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Genorise® Biotinylated Bovine MMP-9 polyclonal antibody
GR134034 50 µg

Genorise® Biotinylated Bovine MMP-9 polyclonal antibody

Sign In for Pricing
View Details
PLANT COLLECTION SETS Xerophytic Plants Collection
4111700/19 1 Each

PLANT COLLECTION SETS Xerophytic Plants Collection

Sign In for Pricing
View Details
Quick Step Rat Vascular Endothelial cell Growth Factor a (VEGF-A) ELISA Kit
QS1157Ra-01 48 Tests

Quick Step Rat Vascular Endothelial cell Growth Factor a (VEGF-A) ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat Vascular Endothelial cell Growth Factor a (VEGF-A) ELISA Kit
QS1157Ra-02 96 Tests

Quick Step Rat Vascular Endothelial cell Growth Factor a (VEGF-A) ELISA Kit

Sign In for Pricing
View Details