Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CBFA2T1 (RUNX1T1)

This Recombinant Human Protein CBFA2T1 (RUNX1T1) spans the amino acid sequence from region 1-604aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-D-related protein; Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2

UniProt

Q06455

Expression Region

1-604aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

74.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBP2 Rabbit pAb
E2852205 100 µL

WBP2 Rabbit pAb

Sign In for Pricing
View Details
APC Anti-human CD169 Antibody *7-239*
116901B0-AAT 25 Tests

APC Anti-human CD169 Antibody *7-239*

Sign In for Pricing
View Details
ECFP-Tag Polyclonal Antibody
E51PA05387 100 µL

ECFP-Tag Polyclonal Antibody

Sign In for Pricing
View Details
HighQCTM Fischer 344 Rat Mesenchymal Stem Cells with GFP
ABC-SC052G 1 Vial

HighQCTM Fischer 344 Rat Mesenchymal Stem Cells with GFP

Sign In for Pricing
View Details
Olfr177 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4170102 1.0 µg DNA

Olfr177 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
TrkB (NTRK2) (NM_001018064) Human Tagged ORF Clone Lentiviral Particle
RC221838L2V 200 µL

TrkB (NTRK2) (NM_001018064) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details