Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat-containing protein 9 (LRRC9), partial

This Recombinant Human Leucine-rich repeat-containing protein 9 (LRRC9), partial spans the amino acid sequence from region 391-625aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LRRC9

UniProt

Q6ZRR7

Expression Region

391-625aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNFHFEEGTRSDDWFNFCYELILSRFCAWDFRTYGITGVKVKRIIKVNNRILRLKFEEKFQKFLENEDMHDSESYRRMLECLFYVFDPEVSVKKKHLLQILEKGFKDSETSKLPLKKEAIIVSNSLSISECPRIEFLQQKHKDEKKISLKHELFRHGILLITKVFLGQSVQAHEKESISQSNYPMVNSVFIPRKYLLNSVMGQRNCDCSVRQCKWFVFDHDLVLPEYVVEFEYIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf46 (SYNE4) Human Gene Knockout Kit (CRISPR)
KN423193 1 Kit

C19orf46 (SYNE4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
TA392594 100 µL

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CLPTM1L activation kit by CRISPRa
GA113018 1 Kit

Human CLPTM1L activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn2r80 Mouse Gene Knockout Kit (CRISPR)
KN519212 1 Kit

Vmn2r80 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF546 (NM_001297763) Human Tagged ORF Clone
RG239612 10 µg

ZNF546 (NM_001297763) Human Tagged ORF Clone

Sign In for Pricing
View Details
Primer Panel
HPP6014D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details