Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 66 Protein E7 (E7)

This Recombinant Human papillomavirus 66 Protein E7 (E7) spans the amino acid sequence from region 1-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7

UniProt

Q80956

Expression Region

1-105aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus 66

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGKVPTLQEVILELAPQTEIDLQCNEQLDSSEDEDEDEIDHLLERPQQARQAEQHKCYLIHVPCCKCELVVQLDIQSTKEELRVVQQLLMGALTVTCPLCASSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMM79, CT (TMEM79, Transmembrane protein 79)
043038 200 µL

TMM79, CT (TMEM79, Transmembrane protein 79)

Sign In for Pricing
View Details
Rat γ Glutamylcsteine synthetase ELISA kit
GTR10371859 96 Well

Rat γ Glutamylcsteine synthetase ELISA kit

Sign In for Pricing
View Details
TRA2B Protein Lysate
OCOA01328-20UG 20 µg

TRA2B Protein Lysate

Sign In for Pricing
View Details
UROC1 (NM_144639) Human Over-expression Lysate
LS131669 100 µg

UROC1 (NM_144639) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Lrrc24 shRNA (UAS) - Lentiviral mouse Lrrc24 shRNA (UAS, iRFP) plasmid
GTR15234592 1 Vial

Lentiviral mouse Lrrc24 shRNA (UAS) - Lentiviral mouse Lrrc24 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit
abx385771 96 Tests

Human Acidic Leucine-Rich Nuclear Phosphoprotein 32 Family Member B (ANP32B) ELISA Kit

Sign In for Pricing
View Details