Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ly6/PLAUR domain-containing protein 1 (Lypd1)

This Recombinant Mouse Ly6/PLAUR domain-containing protein 1 (Lypd1) spans the amino acid sequence from region 21-115aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ly-6/neurotoxin-like protein 2

UniProt

Q8BLC3

Expression Region

21-115aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH6 Polyclonal Antibody
orb399586-01 50 μL

MYH6 Polyclonal Antibody

Sign In for Pricing
View Details
MYH6 Polyclonal Antibody
orb399586-02 100 µL

MYH6 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human SLC12A2 shRNA (UAS) - Lentiviral human SLC12A2 shRNA (UAS, iRFP) (25)
GTR15114266 1 Vial

Lentiviral human SLC12A2 shRNA (UAS) - Lentiviral human SLC12A2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RN5S438 Protein Vector (Human) (pPM-C-His)
PV117429 500 ng

RN5S438 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GLRX2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
21623111 3x 1.0 µg

GLRX2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
MSLNL Protein Vector (Mouse) (pPM-C-HA)
PV202448 500 ng

MSLNL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details