Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT)

This Recombinant Human Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (AADAT) spans the amino acid sequence from region 30-425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

2-aminoadipate aminotransferase;2-aminoadipate transaminase; Alpha-aminoadipate aminotransferase; Glycine transaminase AADAT; Kynurenine aminotransferase II; Kynurenine--glyoxylate transaminase AADAT; Kynurenine--oxoglutarate aminotransferase II; Kynurenine--oxoglutarate transaminase 2; Kynurenine--oxoglutarate transaminase II; Methionine--glyoxylate transaminase AADAT

UniProt

Q8N5Z0

Expression Region

30-425aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

88.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PKD2L2 Antibody [DyLight 550]
NBP2-97274R 0.1 mL

Rabbit Polyclonal PKD2L2 Antibody [DyLight 550]

Sign In for Pricing
View Details
PCMV-H3C1-3xHA-Neo Plasmid
PVT76911 2 µg

PCMV-H3C1-3xHA-Neo Plasmid

Sign In for Pricing
View Details
Phospho-BAD (Ser99) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5219R-BF555 100 µL

Phospho-BAD (Ser99) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
ATG4D siRNA (Human)
orb1854521-01 15 nmol

ATG4D siRNA (Human)

Sign In for Pricing
View Details
ATG4D siRNA (Human)
orb1854521-02 30 nmol

ATG4D siRNA (Human)

Sign In for Pricing
View Details
Mouse Monoclonal C16orf72 Antibody (OTI2D1) [Janelia Fluor 646]
NBP2-71842JF646 0.1 mL

Mouse Monoclonal C16orf72 Antibody (OTI2D1) [Janelia Fluor 646]

Sign In for Pricing
View Details