Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial

This Recombinant Human Transmembrane protease serine 4 (TMPRSS4), partial spans the amino acid sequence from region 54-437aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Channel-activating protease 2; Membrane-type serine protease 2

UniProt

Q9NRS4

Expression Region

54-437aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ASB1 Antibody
39940 100 µL

Anti-ASB1 Antibody

Sign In for Pricing
View Details
Mucicarmine Southgate Stain Kit
RRSK13-500 500 Tests

Mucicarmine Southgate Stain Kit

Sign In for Pricing
View Details
RPS11, ID (RPS11, 40S ribosomal protein S11) (MaxLight 405) discontinued
041231-ML405 100 µL

RPS11, ID (RPS11, 40S ribosomal protein S11) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Smarcd2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4046704 1.0 µg DNA

Smarcd2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ASFV CD2v/pEP402R/CD2H Protein (C-His, African swine fever virus)
P500697 100 µg

ASFV CD2v/pEP402R/CD2H Protein (C-His, African swine fever virus)

Sign In for Pricing
View Details
c-erbB-2/HER-2, Antibody
GWB-2E2A00 1 mL

c-erbB-2/HER-2, Antibody

Sign In for Pricing
View Details