Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial

This Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial spans the amino acid sequence from region 20-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium-independent alpha-latrotoxin receptor 3; Latrophilin-3; Lectomedin-3

UniProt

Q9HAR2

Expression Region

20-425aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Influenza B virus Nucleoprotein (NP), partial
CSB-YP356318IJU-01 20 µg

Recombinant Influenza B virus Nucleoprotein (NP), partial

Sign In for Pricing
View Details
Recombinant Influenza B virus Nucleoprotein (NP), partial
CSB-YP356318IJU-02 100 µg

Recombinant Influenza B virus Nucleoprotein (NP), partial

Sign In for Pricing
View Details
Recombinant Influenza B virus Nucleoprotein (NP), partial
CSB-YP356318IJU-03 1 mg

Recombinant Influenza B virus Nucleoprotein (NP), partial

Sign In for Pricing
View Details
GMPS Rabbit Polyclonal Antibody (Fluoro550)
orb3107411 100 µg

GMPS Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
General PGE2/Prostaglandin E2 ELISA Kit
E0056Ge 96 Tests

General PGE2/Prostaglandin E2 ELISA Kit

Sign In for Pricing
View Details
Iceberg (Caspase-1 Inhibitor Iceberg, Caspase Recruitment Domain Family Member 18, Caspase Recruitment Domain-containing Protein 18, CARD18, pseudo-ICE, UNQ5804/PRO19611) discontinued
I0620-06 100 µg

Iceberg (Caspase-1 Inhibitor Iceberg, Caspase Recruitment Domain Family Member 18, Caspase Recruitment Domain-containing Protein 18, CARD18, pseudo-ICE, UNQ5804/PRO19611) discontinued

Sign In for Pricing
View Details