Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe

This Recombinant Notechis scutatus scutatus Acidic phospholipase A2 HTe spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

Q9PSN5

Expression Region

1-125aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Notechis scutatus scutatus (Mainland tiger snake)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLYQFGNMIQCANHGRRPTRHYMDYGCYCGKGGSGTPVDELDRCCQTHDDCYGEAEKLPACNYMMSGPYYNTYSYECNEGELTCKDNNDECKAFICNCDRTAAICFARAPYNDANWNIDTKTRCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal c-Fos Antibody (RM374)
NBP2-77432 100 µL

Rabbit Monoclonal c-Fos Antibody (RM374)

Sign In for Pricing
View Details
GM5113 Adenovirus (Mouse)
22071054 1.0 mL

GM5113 Adenovirus (Mouse)

Sign In for Pricing
View Details
KIF20A Polyclonal Antibody, APC-Cy7 Conjugated
bs-7750R-APC-Cy7 100 µL

KIF20A Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Pigeon Leucine-Rich Repeat-Containing Protein 19 (LRRC19) ELISA Kit
MBS9944079 Inquire

Pigeon Leucine-Rich Repeat-Containing Protein 19 (LRRC19) ELISA Kit

Sign In for Pricing
View Details
Mouse 1700123M08Rik activation kit by CRISPRa
GA219506 1 Kit

Mouse 1700123M08Rik activation kit by CRISPRa

Sign In for Pricing
View Details
PRAME Family Member 10 (PRAMEF10) Antibody
abx026179-01 80 µL

PRAME Family Member 10 (PRAMEF10) Antibody

Sign In for Pricing
View Details